Verb Reference: kita

Kita belongs to several high-frequency networks. It underlies verbs for seeing, meeting, showing, appearing, and earning; bare kita can mean visible or earnings. Filipino also has an unrelated composite pronoun kita meaning “I ... you,” as in Nakita kita “I saw you.” Context, affixes, and markers keep these meanings apart.

This is exactly why a root reference is more useful than an English-style conjugation list. English see, meet, show, and earn look unrelated, while several Filipino families share the written root kita but have different valency and lexical meanings.

Core forms and functions

All unmarked forms below are (neutral).

FamilyBasicCompletedIncompletedContemplatedTypical pivot
patient-oriented perceptionmakitanakitanakikitamakikitaperson or thing perceived
actor-oriented perception/abilitymakakitanakakitanakakakitamakakakitaperceiver; perceived entity takes ng
reciprocal meetingmagkitanagkitanagkikitamagkikitaplural set of people who meet
participatory meetingmakipagkitanakipagkitanakikipagkitamakikipagkitaperson who intentionally meets with another; counterpart takes kay/sa
patient/conveyance voice showingipakitaipinakitaipinapakitaipapakitathing, evidence, or behavior shown
actor voice showing/appearingmagpakitanagpakitanagpapakitamagpapakitaperson or phenomenon that appears, presents itself, or displays something
actor voice earningkumitakumitakumikitakikitaearner; earnings take ng
patient voice meetingkitainkinitakinikitakikitainselected person to be met
patient voice earningkitainkinitakinikitakikitainselected income, amount, or profit earned

Accepted root-copy variants nakakikita/makakikita occur especially in (formal) or (literary) writing beside widespread contemporary nakakakita/makakakita. For ipakita, careful root-copy ipinakikita/ipakikita also occurs beside widespread ipinapakita/ipapakita. The alternatives preserve the same participant frames.

Makita and makakita: perceived entity versus perceiver

Makita selects the person or thing perceived with ang/si. The perceiver takes an ng-series form. Makakita selects the perceiver with ang/si, and what is seen normally takes ng.

Nakakita si Amira ng kuwagong nakadapo sa bakod.

Amira saw an owl perched on the fence. (perceiver pivot; neutral)

Nakita ni Amira ang kuwagong nakadapo sa bakod.

Amira saw the owl perched on the fence. (perceived-entity pivot; neutral)

The English clauses differ only in the article, but the Filipino contrast is structural: si Amira ... ng kuwago versus ni Amira ang kuwago. Discourse familiarity often supports the English “an/the” difference, yet ng and ang are not simply indefinite and definite articles.

Nakikita ng bantay ang buong paradahan mula sa ikalawang palapag.

The guard can see the entire parking area from the second floor. (incompleted patient-oriented perception; neutral)

Makakakita kayo ng mga alitaptap kapag tuluyang dumilim.

You will be able to see fireflies when it becomes completely dark. (contemplated actor-oriented perception; neutral)

These families often translate simply as see. The ma-/maka- morphology does not force an “accidental” meaning in every sentence. Their most dependable difference is which participant is pivot. See the ma- stative/ability family and the maka- ability family.

💡
Choose by participant structure: nakita ni Ana ang bagay selects what Ana saw; nakakita si Ana ng bagay selects Ana as perceiver.

Kita and kitang-kita: visible or obvious

Bare adjective/predicate kita means visible. Intensified kitang-kita means clearly visible or obvious. No overt copula equivalent to English be is required.

Kita mula sa bubong ang ilog at ang lumang tulay.

The river and the old bridge are visible from the roof. (adjectival predicate; neutral)

Kitang-kita sa mukha ni Tino na nabigla siya sa balita.

It is completely obvious from Tino's face that the news surprised him. (intensified figurative visibility; neutral)

The linker-like -ng in kitang-kita belongs to the fixed intensified form. Do not separate it as kita na kita when the intended established expression is “clearly visible.”

Magkita and makipagkita: meeting

Magkita presents two or more people as a reciprocal set. A coordinated set commonly takes sina or a plural pronoun. Makipagkita selects one participant and marks the counterpart with kay/sa; it often suggests an intentional meeting or appointment.

Nagkita sina Celia at Omar sa munisipyo pagkatapos ng tanghalian.

Celia and Omar met at the municipal hall after lunch. (completed reciprocal meeting; neutral)

Makikipagkita si Celia kay Omar para talakayin ang badyet.

Celia will meet with Omar to discuss the budget. (contemplated participatory meeting; neutral)

Hindi na nagkikita ang dating magkaklase dahil magkakalayo na sila.

The former classmates no longer see one another because they now live far apart. (negative incompleted reciprocal meeting; neutral)

The patient series kitain/kinita/kinikita/kikitain also commonly selects a person to be met:

Kikitain ko si Omar sa harap ng museo pagkatapos ng trabaho.

I will meet Omar in front of the museum after work. (contemplated patient meeting; neutral)

These forms are identical to the patient earning series, but the semantic type of the pivot normally resolves the reading: si Omar is a person to be met, while ang halagang iyon can be money earned. Makipagkita kay or magkita tayo may still be clearer where context leaves room for ambiguity.

Ipakita and magpakita: showing versus appearing

Ipakita selects what is shown: an object, record, skill, reaction, or evidence. The viewer or recipient normally takes sa/kay. Magpakita selects the person or phenomenon that appears, presents itself, or displays a non-pivot item.

Ipinakita ng arkitekto sa mga residente ang binagong plano.

The architect showed the residents the revised plan. (completed patient/conveyance voice; neutral)

Ipapakita ko sa inyo ang tamang pagkabit ng pansala.

I will show you how to attach the filter correctly. (contemplated patient/conveyance voice; neutral)

Nagpakita ng matinding pag-aalala ang mga magulang sa pulong.

The parents showed deep concern at the meeting. (completed actor voice; neutral)

In nagpakita ng pag-aalala, the parents are pivot and the displayed reaction takes ng. In ipinakita ... ang plano, the plan is pivot. Magpakita can also mean appear: Hindi nagpakita ang saksi “The witness did not appear.” This is a conventional lexical extension, not merely “cause to see oneself.”

Kumita and kitain: earning

The earnings branch uses actor-voice kumita for the earner and patient-voice kitain for a selected amount or income. Bare noun kita means earnings, revenue, or profit according to context.

Kumikita ng sapat para sa matrikula si Lando sa pag-aayos ng bisikleta.

Lando earns enough for tuition by repairing bicycles. (incompleted actor voice; neutral)

Kinita ng munting tindahan ang limampung libong piso sa loob ng anim na buwan.

The small shop earned fifty thousand pesos within six months. (completed patient voice; neutral)

Magkano ang kikitain natin kung maibebenta ang lahat ng punla?

How much will we earn if all the seedlings can be sold? (interrogative contemplated patient voice; neutral)

Kikita selects the earner and kikitain selects the projected earnings: Kikita ang tindahan ng sampung libo versus Sampung libo ang kikitain ng tindahan. The final -in changes voice and participant marking, not merely formality.

The unrelated pronoun kita

Composite pronoun kita replaces an impossible sequence ko ka when a first-person singular non-pivot actor acts on a second-person singular pivot. It is not the root kita and does not belong in the aspect table.

Nakita kita sa may lumang tore bago magtanghali.

I saw you near the old tower before noon. (patient-oriented perception plus composite pronoun)

The first word nakita is the completed perception verb. The second kita jointly expresses “by me” and “you.” See the special placement of ka and kita.

—Magkikita ba tayo sa Sabado? —Oo, ipapakita ko rin sa iyo ang bagong silid-aklatan.

—Are we meeting on Saturday? —Yes, and I will also show you the new library. (neutral exchange)

Common Mistakes

Giving makakita an ang-marked perceived entity

❌ Nakakita si Amira ang kuwago sa bakod.

Incorrect — makakita selects the perceiver, so the perceived entity takes ng.

✅ Nakakita si Amira ng kuwago sa bakod.

Amira saw an owl on the fence. (actor-oriented perception; neutral)

Keeping the perceiver as a si phrase with nakita

❌ Nakita si Amira ang kuwago sa bakod.

Incorrect — nakita selects the owl, so the personal-name perceiver takes ni.

✅ Nakita ni Amira ang kuwago sa bakod.

Amira saw the owl on the fence. (patient-oriented perception; neutral)

Combining reciprocal magkita with singular patient markers

❌ Nagkita ni Celia si Omar sa munisipyo.

Incorrect — reciprocal magkita selects the meeting participants as a coordinated set.

✅ Nagkita sina Celia at Omar sa munisipyo.

Celia and Omar met at the municipal hall. (reciprocal meeting; neutral)

Producing ko ka instead of composite kita

❌ Nakita ko ka sa tabi ng lumang tore.

Incorrect — first-person singular actor plus second-person singular pivot is expressed by composite kita.

✅ Nakita kita sa tabi ng lumang tore.

I saw you beside the old tower. (neutral)

💡
Let affixes, markers, and the semantic type of the pivot identify the branch: perception (makita/makakita), meeting (magkita/makipagkita/kitain), showing (ipakita/magpakita), or earning (kumita/kitain). Composite pronoun kita is separate.

Key Takeaways

  • Makita selects the perceived entity; makakita selects the perceiver.
  • Bare kita means visible, while kitang-kita means clearly visible or obvious.
  • Magkita presents a reciprocal meeting set; makipagkita kay selects one participant meeting with another; patient kitain selects the person to be met.
  • Ipakita selects what is shown; magpakita selects whoever appears or displays something.
  • Kumita ... ng selects the earner; kitain ... ang selects earnings or profit.
  • Pronoun kita “I ... you” is a homonymous composite form, not another use of the verb root.

Now practice Filipino

Reading grammar gets you part of the way. The exercises are where it sticks — free, no signup needed.

Start learning Filipino

Related Topics